MAPK9 RAT

Name: Mitogen-activated protein kinase 9 - rat

Alternative names: JNK2,JNK-55, SAPK2, Prkm9

Taxonomy: [Rattus norvegicus] Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Coelomata; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata; Teleostomi; Euteleostomi; Sarcopterygii; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea; Muridae; Murinae; Rattus.

Protein Size: 423 aa

mRNA Size: 3711 bp

MW: 48017 Da

pI: 5.55

Activator MKKs: MAP2K4 (MKK4};MAP2K5 (MKK5); MAP2K7 (MKK7)

Activation site: TPY (pThr-183 and pTyr-185)

Protein sequence [FASTA]:

>mkr|RAN000009|MK9_RAT|Mitogen-activated protein kinase 9 
MSDSKSDGQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVKDQPSDAAVSSKATPSQSSSINDISSMSTEHTLASDTDSSLDASTGPLE
GCR

Cross references

RefSeq: Protein: NP_059018.1. Nucleotide sequence: NM_017322.2.
NCBI Gene: 50658 [ MAPK9 mitogen-activated protein kinase 9 ]
UniProtKB: P49186 [ MAPK9 ]