MAPK8 RAT

Name: Mitogen-activated protein kinase 8 - rat

Alternative names: JNK1,JNK-46, SAPK1, Prkm8

Taxonomy: [Rattus norvegicus] Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Coelomata; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata; Teleostomi; Euteleostomi; Sarcopterygii; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea; Muridae; Murinae; Rattus.

Protein Size: 411 aa

mRNA Size: 5796 bp

MW: 46807 Da

pI: 6.57

Activator MKKs: MAP2K4 (MKK4};MAP2K5 (MKK5); MAP2K7 (MKK7)

Activation site: TPY (pThr-183 and pTyr-185)

Protein sequence [FASTA]:

>mkr|RAN000008|MK8_RAT|Mitogen-activated protein kinase 8 
MSRSKRDNNFYSVEIADSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVCLKILFPGRDYIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPVSSPSVNDMSSMSTDPTLASD

Cross references

RefSeq: Protein: NP_446281.1. Nucleotide sequence: NM_053829.1.
NCBI Gene: 116554 [ MAPK8 mitogen-activated protein kinase 8 ]
UniProtKB: P49185 [ MAPK8 ]