MAPK7 MOUSE

Name: Mitogen-activated protein kinase 7 - mouse

Alternative names: Erk5, BMK-1, Prkm7

Taxonomy: [Mus musculus] Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Coelomata; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata; Teleostomi; Euteleostomi; Sarcopterygii; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea; Muridae; Murinae; Mus; Mus.

Protein Size: 806 aa

mRNA Size: 2945 bp

MW: 87733 Da

pI: 5.52

Activator MKKs: MAP2K3 (MKK3); MAP2K6 (MKK6)

Activation site: TEY (pThr-219 and pTyr-221)

Protein sequence [FASTA]:

>mkr|MUM000007|MK7_MOUSE|Mitogen-activated protein kinase 7  
MAEPLKEEDGEDGSGEPPGRVKAEPVHTAASVVAKNLALLKARSFDVTFDVGDEYEIIET
IGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDI
LKPTVPYGEFRSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIH
RDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYT
QAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQS
LPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCA
PPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPVCPDVEMP
SPWAPSGDCAMESPPPALPPCSDPAPDTVDLTLQPAPPASELAPPKREGAISDNTKAALK
AALLKSLRSRLRDGPSAPLEAPEPRKPVTAQERQREREEKRRRRQERAKEREKRRQERER
KERGAGTLGGPSTDPLAGLVLSDNDRSLLERWTRMARPPAPAPAPAPAPAPAPSSAQPTS
TPTGPVSQSTGPLQPAGSIPGPASQPVCPPPGPVPQPAGPIPAPLQTAPSTSLLASQSLV
PPSGLPGSGAPEVLPYFPSGPPPPDPGLTPQPSTSESPDVNLVTQQLSKSQVEDPLPPVF
SGTPKGSGAGYGVGFDLEEFLNQSFDMGVADGPQDGQADSASLSASLLADWLEGHGMNPA
DIESLQREIQMDSPMLLSDLPDLQEP

Cross references

RefSeq: Protein: NP_035971.1. Nucleotide sequence: NM_011841.1.
NCBI Gene: 23939 [ MAPK7 mitogen-activated protein kinase 7 ]
UniProtKB: Q9WVS8 [ MAPK7 ]