MAPK3 HUMAN

Name: Mitogen-activated protein kinase 3 - human

Alternative names: Erk1, p44-MAPK, PRKM3

Taxonomy: [Homo sapiens] Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Coelomata; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata; Teleostomi; Euteleostomi; Sarcopterygii; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea; Hominidae; Homininae; Homo.

Protein Size: 379 aa

mRNA Size: 1902 bp

MW: 43136 Da

pI: 6.28

Activator MKKs: MAP2K1 (MEK1); MAP2K2 (MEK2)

Activation site: TEY (pThr-202 and pTyr-204)

Protein sequence [FASTA]:

>mkr|HOS000003|MK3_HUMAN|Mitogen-activated protein kinase 3 
MAAAAAQGGGGGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAY
DHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYI
VQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDL
KICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS
NRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD
SKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERL
KELIFQETARFQPGVLEAP

Cross references

RefSeq: Protein: NP_001035145.1. Nucleotide sequence: NM_001040056.1.
RefSeq: Protein: NP_001103361.1. Nucleotide sequence: NM_001109891.1.
RefSeq: Protein: NP_002737.2. Nucleotide sequence: NM_002746.2.
NCBI Gene: 5595 [ MAPK3 mitogen-activated protein kinase 3 ]
UniProtKB: P27361 [ MAPK3 ]
NextProt: NX_P27361 [ Mitogen-activated protein kinase 3 ]
HPRD: 03479 [ ERK1 ]
RCSB PDB: 2ZOQ