MAPK15 RAT

Name: Mitogen-activated protein kinase 15 - rat

Alternative names: Erk7, Erk8

Taxonomy: [Rattus norvegicus] Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Coelomata; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata; Teleostomi; Euteleostomi; Sarcopterygii; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea; Muridae; Murinae; Rattus.

Protein Size: 547 aa

mRNA Size: 1888 bp

MW: 60724 Da

pI: 9.83

Activator MKKs: MAP2K1 (MKK1);MAP2K2 (MKK2)

Activation site: TEY (pThr-175 and pTyr-177)

Protein sequence [FASTA]:

>mkr|RAN000015|MK15_RAT|Mitogen-activated protein kinase 15 
MCAAEVDRHVSQRYLIKRRLGKGAYGIVWKAMDRRTGEVVAIKKIFDAFRDQTDAQRTFR
EIMLLREFGGHPNIIRLLDVIPAKNDRDIYLVFESMDTDLNAVIQKGRLLEDIHKRCIFY
QLLRATKFIHSGRVIHRDQKPANVLLDAACRVKLCDFGLARSLSDFPEGPGGQALTEYVA
TRWYRAPEVLLSSRWYTPGVDMWSLGCILGEMLRGQPLFPGTSTFHQLELILETIPLPSM
EELQGLGSDYSALILQNLGSRPRQTLDALLPPDTPPEALDLLKRLLAFAPDKRLSAEQAL
QHPYVQRFHCPDREWTRGSDVRLPVHEGDQLSAPEYRNRLYQMILERRRNSRSPREEDLG
VVASRAELRASQRQSLKPGVLPQVLAETPARKRGPKPQNGHGHDPEHVEVRRQSSDPLYQ
LPPPGSGERPPGATGEPPSAPSGVKTHVRAVAPSLTSQAAAQAANQPLIRSDPARGGGPR
AVGARRVPSRLPREAPEPRPGRRMFGISVSQGAQGAARAALGGYSQAYGTVCRSALGRLP
LLPGPRA

Cross references

RefSeq: Protein: NP_775453.1. Nucleotide sequence: NM_173331.2.
NCBI Gene: 286997 [ MAPK15 mitogen-activated protein kinase 15 ]
UniProtKB: Q9Z2A6 [ MAPK15 ]