MAPK15 HUMAN

Name: Mitogen-activated protein kinase 15 - human

Alternative names: Erk7, Erk8

Taxonomy: [Homo sapiens] Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Coelomata; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata; Teleostomi; Euteleostomi; Sarcopterygii; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea; Hominidae; Homininae; Homo.

Protein Size: 544 aa

mRNA Size: 1904 bp

MW: 59832 Da

pI: 9.17

Activator MKKs: MAP2K1 (MKK1);MAP2K2 (MKK2)

Activation site: TEY (pThr-175 and pTyr-177)

Protein sequence [FASTA]:

>mkr|HOS000015|MK15_HUMAN|Mitogen-activated protein kinase 15 
MCTVVDPRIVRRYLLRRQLGQGAYGIVWKAVDRRTGEVVAIKKIFDAFRDKTDAQRTFRE
ITLLQEFGDHPNIISLLDVIRAENDRDIYLVFEFMDTDLNAVIRKGGLLQDVHVRSIFYQ
LLRATRFLHSGHVVHRDQKPSNVLLDANCTVKLCDFGLARSLGDLPEGPEDQAVTEYVAT
RWYRAPEVLLSSHRYTLGVDMWSLGCILGEMLRGRPLFPGTSTLHQLELILETIPPPSEE
DLLALGSGCRASVLHQLGSRPRQTLDALLPPDTSPEALDLLRRLLVFAPDKRLSATQALQ
HPYVQRFHCPSDEWAREADVRPRAHEGVQLSVPEYRSRVYQMILECGGSSGTSREKGPEG
VSPSQAHLHKPRADPQLPSRTPVQGPRPRPQSSPGHDPAEHESPRAAKNVPRQNSAPLLQ
TALLGNGERPPGAKEAPPLTLSLVKPSGRGAAPSLTSQAAAQVANQALIRGDWNRGGGVR
VASVQQVPPRLPPEARPGRRMFSTSALQGAQGGARALLGGYSQAYGTVCHSALGHLPLLE
GHHV

Cross references

RefSeq: Protein: NP_620590.2. Nucleotide sequence: NM_139021.2.
NCBI Gene: 225689 [ MAPK15 mitogen-activated protein kinase 15 ]
UniProtKB: Q8TD08 [ MAPK15 ]
NextProt: NX_Q8TD08 [ Mitogen-activated protein kinase 15 ]
HPRD: 16867 [ MAPK15 ]