MAPK14B ZEBRAFISH

Name: Mitogen-activated protein kinase 14B - zebrafish

Alternative names: P38alpha, SAPK2a, CSBP, CSBP1, CSBP2, CSPB1, MXI2

Taxonomy: [Danio rerio] Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Coelomata; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata; Teleostomi; Euteleostomi; Actinopterygii; Actinopteri; Neopterygii; Teleostei; Elopocephala; Clupeocephala; Otocephala; Ostariophysi; Otophysi; Cypriniphysi; Cypriniformes; Cyprinoidea; Cyprinidae; Danio.

Protein Size: 348 aa

mRNA Size: 1544 bp

MW: 39998 Da

pI: 6.36

Activator MKKs: MAP2K3 (MKK3); MAP2K5 (MKK5); MAP2K6 (MKK6)

Activation site: TGY (pThr-181 and pTyr-183)

Protein sequence [FASTA]:

>mkr|DAR000028|MK14B_ZEBRAFISH|Mitogen-activated protein kinase 14B 
MSQKARPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVMSAFDGKAGLRVAVKKLSRPF
QSIIHAKRTYRELRLLKHMKHENVIGLLDVFSPATSLEGFNDVYLVTHLMGADLNNIVKC
QKLTDDHVQFLIYQILRALKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARLTDDEM
TGYVATRWYRAPEIMLNWMHYNMTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLT
GTPPASLISRMPSHEARNYISSLPHMPKRNFADVFIGANPLAVDLLEKMLVLDTDKRITA
SQALAHPYFAQYHDPDDEPEADPYDQSFESRDLEIEEWKSKIYIQNRN

Cross references

RefSeq: Protein: NP_835741.1. Nucleotide sequence: NM_178223.2.
NCBI Gene: 266756 [ MAPK14B mitogen-activated protein kinase 14B ]
UniProtKB: Q9DGE1 [ MAPK14 ]