MAPK14A ZEBRAFISH

Name: Mitogen-activated protein kinase 14A - zebrafish

Alternative names: P38alpha, SAPK2a, CSBP, CSBP1, CSBP2, CSPB1, MXI2

Taxonomy: [Danio rerio] Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Coelomata; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata; Teleostomi; Euteleostomi; Actinopterygii; Actinopteri; Neopterygii; Teleostei; Elopocephala; Clupeocephala; Otocephala; Ostariophysi; Otophysi; Cypriniphysi; Cypriniformes; Cyprinoidea; Cyprinidae; Danio.

Protein Size: 361 aa

mRNA Size: 2287 bp

MW: 41633 Da

pI: 5.48

Activator MKKs: MAP2K3 (MKK3); MAP2K5 (MKK5); MAP2K6 (MKK6)

Activation site: TGY (pThr-180 and pTyr-182)

Protein sequence [FASTA]:

>mkr|DAR000014|MK14A_ZEBRAFISH|Mitogen-activated protein kinase 14A 
MSQKERPTFYRQEVNKTIWEVPVQYQNLSPVGSGAYGSVCSAFDAKTGFKVAVKKLSRPF
QSIIHAKRTYRELRLLKHMRHENVIGLLDVFTPATSLKEFNDVYLVTHLMGADLNNIVKC
QKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEM
TGYVATRWYRAPEIMLNWMHYNVTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLT
GTPPSSLISRMPSHEARTYISSLPQMPKRNFADVFIGANPQAVDLLEKMLVLDTDKRITA
AEALAHPYFAQYHDPDDEPEAEPFDQSFESRELDIEEWKRQTYEEMISFEPPVFDVDEME
S

Cross references

RefSeq: Protein: NP_571797.1. Nucleotide sequence: NM_131722.1.
NCBI Gene: 65237 [ MAPK14A mitogen-activated protein kinase 14A ]
UniProtKB: Q9DGE2 [ MAPK14 ]