MAPK14 RAT

Name: Mitogen-activated protein kinase 14 - rat

Alternative names: P38alpha, SAPK2a, CSBP, CSBP1, CSBP2, CSPB1, MXI2

Taxonomy: [Rattus norvegicus] Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Coelomata; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata; Teleostomi; Euteleostomi; Sarcopterygii; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea; Muridae; Murinae; Rattus.

Protein Size: 360 aa

mRNA Size: 3452 bp

MW: 41321 Da

pI: 5.55

Activator MKKs: MAP2K3 (MKK3); MAP2K5 (MKK5); MAP2K6 (MKK6)

Activation site: TGY (pThr-180 and pTyr-182)

Protein sequence [FASTA]:

>mkr|RAN000014|MK14_RAT|Mitogen-activated protein kinase 14 
MSQERPTFYRQELNKTVWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVAEPYDQSFESRDFLIDEWKSLTYDEVISFVPPPLDQEEMES

Cross references

RefSeq: Protein: NP_112282.2. Nucleotide sequence: NM_031020.2.
NCBI Gene: 81649 [ MAPK14 mitogen-activated protein kinase 14 ]
UniProtKB: P70618 [ MAPK14 ]