MAPK14 DOG

Name: Mitogen-activated protein kinase 14 - dog

Alternative names: P38alpha, SAPK2a, CSBP, CSBP1, CSBP2, CSPB1, MXI2

Taxonomy: [Canis lupus familiaris] Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Coelomata; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata; Teleostomi; Euteleostomi; Sarcopterygii; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae; Canis; Canis lupus.

Protein Size: 360 aa

mRNA Size: 1083 bp

MW: 41265 Da

pI: 5.48

Activator MKKs: MAP2K3 (MKK3); MAP2K5 (MKK5); MAP2K6 (MKK6)

Activation site: TGY (pThr-180 and pTyr-182)

Protein sequence [FASTA]:

>mkr|CAF000014|MK14_DOG|Mitogen-activated protein kinase 14 
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGADLLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVVSFVPPPLDQEEMES

Cross references

RefSeq: Protein: NP_620581.1. Nucleotide sequence: NM_001003206.1.
NCBI Gene: 403856 [ MAPK14 mitogen-activated protein kinase 14 ]
UniProtKB: O02812 [ MAPK14 ]