MAPK14 CHIMPANZEE

Name: Mitogen-activated protein kinase 14 - chimpanzee

Alternative names: P38alpha, SAPK2a, CSBP, CSBP1, CSBP2, CSPB1, MXI2

Taxonomy: [Pan troglodytes] Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Coelomata; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata; Teleostomi; Euteleostomi; Sarcopterygii; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea; Hominidae; Homininae; Pan.

Protein Size: 360 aa

mRNA Size: 1135 bp

MW: 41493 Da

pI: 5.54

Activator MKKs: MAP2K3 (MKK3); MAP2K5 (MKK5); MAP2K6 (MKK6)

Activation site: TGY (pThr-180 and pTyr-182)

Protein sequence [FASTA]:

>mkr|PAT000014|MK14_CHIMPANZEE|Mitogen-activated protein kinase 14 
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTG
TPPAYLINRMPSHEARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES

Cross references

RefSeq: Protein: NP_001009065.1. Nucleotide sequence: NM_001009065.1.
NCBI Gene: 450161 [ MAPK14 mitogen-activated protein kinase 14 ]
UniProtKB: Q95NE7 [ MAPK14 ]