MAPK13 CHIMPANZEE

Name: Mitogen-activated protein kinase 13 - chimpanzee

Alternative names: P38delta, SAPK4, PRKM13

Taxonomy: [Pan troglodytes] Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Coelomata; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata; Teleostomi; Euteleostomi; Sarcopterygii; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea; Hominidae; Homininae; Pan.

Protein Size: 365 aa

mRNA Size: 1128 bp

MW: 42109 Da

pI: 8.21

Activator MKKs: MAP2K3 (MKK3); MAP2K5 (MKK5); MAP2K6 (MKK6)

Activation site: TGY (pThr-180 and pTyr-182)

Protein sequence [FASTA]:

>mkr|PAT000013|MK13_CHIMPANZEE|Mitogen-activated protein kinase 13 
MSLIRKKGFYKQDVNKXXXELXKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPF
QSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFHDFYLVMXFMQTDLQKIMXM
EFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG
VPGTEFVQKLNDXAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAA
QALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRR
XGXKL

Cross references

RefSeq: Protein: NP_001029261.1 . Nucleotide sequence: NM_001034089.1.
NCBI Gene: 462644 [ MAPK13 mitogen-activated protein kinase 13 ]
UniProtKB: Q9N272 [ MAPK13 ]