MAPK10 RAT

Name: Mitogen-activated protein kinase 10 - rat

Alternative names: JNK3, JNK-49, Prkm10

Taxonomy: [Rattus norvegicus] Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Coelomata; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata; Teleostomi; Euteleostomi; Sarcopterygii; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea; Muridae; Murinae; Rattus.

Protein Size: 464 aa

mRNA Size: 2759 bp

MW: 52530 Da

pI: 6.37

Activator MKKs: MAP2K4 (MKK4};MAP2K5 (MKK5); MAP2K7 (MKK7)

Activation site: TPY (pThr-221 and pTyr-223)

Protein sequence [FASTA]:

>mkr|RAN000010|MK10_RAT|Mitogen-activated protein kinase 10 
MSLHFLYYCSEPTLDVKIAFCQGFDKHVDVSSVVKHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLSAIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYIN
VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA
VNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR

Cross references

RefSeq: Protein: NP_001257485.1. Nucleotide sequence: NM_001270556.1.
NCBI Gene: 25272 [ MAPK10 mitogen-activated protein kinase 10 ]
UniProtKB: P49187 [ MAPK10 ]