Erk2-Xenopus laevis
Name: Mitogen-activated protein kinase 1 - xenopus
Alternative names: Erk2, p42-MAPK, MAPK2
Taxonomy: [Xenopus laevis] Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Coelomata; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata; Teleostomi; Euteleostomi; Sarcopterygii; Tetrapoda; Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae; Xenopodinae; Xenopus; Xenopus.
Protein Size: 361 aa
mRNA Size: 4730 bp
MW: 41257 Da
pI: 6.5
Activator MKKs: MAP2K1 (MEK1); MAP2K2 (MEK2)
Activation site: TEY (pThr-188 and pTyr-190)
Protein sequence [FASTA]:
>mkr|XEL000001|MK1_XENOPUS|Mitogen-activated protein kinase 1 MAAAGAASNPGGGPEMVRGQAFDVGPRYINLAYIGEGAYGMVCSAHDNVNKVRVAIKKIS PFEHQTYCQRTLREIKILLRFKHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLK TQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPD HDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQL NHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADPKALDLLDKMLTFN PHKRIEVEAALAHPYLEQYYDPSDEPVAEAPFKFEMELDDLPKETLKELIFEETARFQPG Y
Cross references
RefSeq: Protein: NP_001083548.1.
Nucleotide sequence: NM_001090079.1.
NCBI Gene: 398985
[ MAPK1 mitogen-activated protein kinase 1 ]
UniProtKB: P26696
[ MAPK1 ]
Erk1/2 in Different Species




Latest MAP Kinase news
The Biochemistry, Biology and Pathology of MAP Kinases II, September 11-12, 2014, Vilnius, Lithuania
It`s our pleasure to invite you to the international event "The Biochemistry, Biology and Pathology of MAP Kinases II". The conference is organized by Enterprise Lithuania together with Swiss...
Next-Gen Kinase Inhibitors Conference - Cambridge Healthtech Institute, June 17 - 19, 2013
This established and well-recognized kinase conference addresses reoccurring questions about selectivity, safety, resistance and novelty. After many years of research and therapeutic developments of...
Control of the cell cycle progression by the MAPK Hog1
Eukaryotic cells coordinate various intracellular activities in response to environmental stresses, activating an adaptive program to maximize the probability of survival and proliferation. Cells...
Ultrasensitive MAPK/Erk activation in absence of protein synthesis in Xenopus oocytes
The mitogen-activated protein kinase (MAPK) cascade in Xenopus oocytes exhibits an all-or-none, ultrasensitive response, which is believed to result from a positive feed-back loop. Here we describe a...
Batsheva de Rothschild Seminar on Biochemistry, Biology and Pathology of MAP Kinases
This abstract book contains most of the abstracts presented to the Batsheva de Rothschild Seminar on Biochemistry, Biology and Pathology of MAP Kinases. An Aharon Katzir-Katchalski Meeting and an...