MAPK1 MOUSE

Name: Mitogen-activated protein kinase 1 - mouse

Alternative names: Erk2, p42-MAPK, MAPK2

Taxonomy: [Mus musculus] Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Coelomata; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata; Teleostomi; Euteleostomi; Sarcopterygii; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea; Muridae; Murinae; Mus; Mus.

Protein Size: 358 aa

mRNA Size: 5099 bp

MW: 41276 Da

pI: 6.5

Activator MKKs: MAP2K1 (MEK1); MAP2K2 (MEK2)

Activation site: TEY (pThr-183 and pTyr-185)

Protein sequence [FASTA]:

>mkr|MUM000001|MK1_MOUSE|Mitogen-activated protein kinase 1 
MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQ
TYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLS
NDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTG
FLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILG
ILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRI
EVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS

Cross references

RefSeq: Protein: NP_001033752.1. Nucleotide sequence: NM_001038663.1.
RefSeq: Protein: NP_036079.1. Nucleotide sequence: NM_011949.3.
NCBI Gene: 26413 [ MAPK1 mitogen-activated protein kinase 1 ]
UniProtKB: P63085 [ MAPK1 ]




Writing for MAPK resource
MAP kinase resource community
MAP Kinase Wiki
MAP Kinase Conference 2014

Latest MAP Kinase news

The Biochemistry, Biology and Pathology of MAP Kinases II, September 11-12, 2014, Vilnius, Lithuania

It`s our pleasure to invite you to the international event "The Biochemistry, Biology and Pathology of MAP Kinases II". The conference is organized by Enterprise Lithuania together with Swiss...

Next-Gen Kinase Inhibitors Conference - Cambridge Healthtech Institute, June 17 - 19, 2013

This established and well-recognized kinase conference addresses reoccurring questions about selectivity, safety, resistance and novelty. After many years of research and therapeutic developments of...

Control of the cell cycle progression by the MAPK Hog1

Eukaryotic cells coordinate various intracellular activities in response to environmental stresses, activating an adaptive program to maximize the probability of survival and proliferation. Cells...

Ultrasensitive MAPK/Erk activation in absence of protein synthesis in Xenopus oocytes

The mitogen-activated protein kinase (MAPK) cascade in Xenopus oocytes exhibits an all-or-none, ultrasensitive response, which is believed to result from a positive feed-back loop. Here we describe a...

Batsheva de Rothschild Seminar on Biochemistry, Biology and Pathology of MAP Kinases

This abstract book contains most of the abstracts presented to the Batsheva de Rothschild Seminar on Biochemistry, Biology and Pathology of MAP Kinases. An Aharon Katzir-Katchalski Meeting and an...


Project Sponsors & Friends


Swiss Institute of Bioinformatics Journalism differently - journalism about mass media

Lithuanian Biotechnology Association Enterprise Lithuania

PAGEPress Publications - scholarly open access journals International Society for Biocuration

brightstat.com

European Bioinformatics Institute

The Coins

DNASU

Ziedavimas
Cancers